Rabbit polyclonal anti-RAB11FIP2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAB11FIP2. |
Rabbit polyclonal anti-RAB11FIP2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAB11FIP2. |
Rabbit Polyclonal Anti-RAB11FIP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAB11FIP2 antibody: synthetic peptide directed towards the N terminal of human RAB11FIP2. Synthetic peptide located within the following region: LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF |