Rabbit Polyclonal Anti-RAB3D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB3D antibody: synthetic peptide directed towards the C terminal of human RAB3D. Synthetic peptide located within the following region: KENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSS |
Anti-Rab3D Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 202-216 amino acids of Human RAB3D, member RAS oncogene family |
RAB3D Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-219 of human RAB3D (NP_004274.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
