Antibodies

Jump to Filters
View as table Download
RAB3IL1 Rabbit Polyclonal Antibody
TA345118

USD 475.00

5 Days

Rabbit Polyclonal Anti-RAB3IL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB3IL1 antibody: synthetic peptide directed towards the middle region of human RAB3IL1. Synthetic peptide located within the following region: PTVKVAEVDCSSTNTCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITA
RAB3IL1 Rabbit Polyclonal Antibody
TA345119

USD 475.00

5 Days

Rabbit Polyclonal Anti-RAB3IL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB3IL1 antibody: synthetic peptide directed towards the middle region of human RAB3IL1. Synthetic peptide located within the following region: ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRH
RAB3IL1 (C-term) Rabbit Polyclonal Antibody
AP53546PU-N

USD 450.00

2 Weeks

RAB3IL1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 297-325 amino acids from the C-terminal region of Human RAB3IL1
RAB3IL1 Mouse Monoclonal Antibody [Clone ID: OTI1B5]
CF504958

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAB3IL1 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RAB3IL1 Rabbit Polyclonal Antibody
TA366249

USD 380.00

4 Weeks

RAB3IL1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RAB3IL1
RAB3IL1 Rabbit Polyclonal Antibody
TA370599

USD 380.00

4 Weeks

RAB3IL1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RAB3IL1
RAB3IL1 Mouse Monoclonal Antibody [Clone ID: OTI1B5]
TA504958

USD 379.00

In Stock

RAB3IL1 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RAB3IL1 Mouse Monoclonal Antibody [Clone ID: OTI1B5]
TA504958S

USD 159.00

2 Days

RAB3IL1 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated