Rabbit Polyclonal Anti-RAB40C Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAB40C antibody is: synthetic peptide directed towards the C-terminal region of Human RAB40C. Synthetic peptide located within the following region: MANGMNAVMMHGRSYSLASGAGGGGSKGNSLKRSKSIRPPQSPPQNCSRS |
Rabbit Polyclonal Anti-RAB40C Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB40C antibody: synthetic peptide directed towards the N terminal of human RAB40C. Synthetic peptide located within the following region: QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS |
Germany
Japan
United Kingdom
China