Germany
Japan
United Kingdom
China
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Antibodies
View as table Download
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Mouse Anti-Human RAC1 Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-RAC1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 198-211 amino acids of Human ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) |
RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human RAC1 |
Rac1/2/3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human Rac1/2/3 (NP_008839.2). |
| Modifications | Unmodified |
Phospho-Rac1/2/3-S71 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S71 of human RAC1 (NP_008839.2). |
| Modifications | Phospho S71 |
Active filters
Target Symbol
- RAC1
Filter by
Category
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
Pathways
- Adherens junction (6)
- Amyotrophic lateral sclerosis (ALS) (6)
- Axon guidance (6)
- B cell receptor signaling pathway (6)
- Chemokine signaling pathway (6)
- Colorectal cancer (6)
- Epithelial cell signaling in Helicobacter pylori infection (6)
- Fc epsilon RI signaling pathway (6)
- Fc gamma R-mediated phagocytosis (6)
- Focal adhesion (6)
- Leukocyte transendothelial migration (6)
- MAPK signaling pathway (6)
- Natural killer cell mediated cytotoxicity (6)
- Neurotrophin signaling pathway (6)
- Pancreatic cancer (6)
- Pathways in cancer (6)
- Regulation of actin cytoskeleton (6)
- Renal cell carcinoma (6)
- Toll-like receptor signaling pathway (6)
- VEGF signaling pathway (6)
- Viral myocarditis (6)
- Wnt signaling pathway (6)