Antibodies

View as table Download

TA332591

USD 275.00

3 Weeks

Rabbit anti-RACGAP1 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Mouse, Human, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human RACGAP1

RACGAP1 Rabbit Polyclonal Antibody

TA308788

USD 415.00

In Stock

Rabbit Polyclonal antibody to RACGAP1 (Rac GTPase activating protein 1)

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 202 of RACGAP1 (Uniprot ID#Q9H0H5)

RACGAP1 (N-term) Rabbit Polyclonal Antibody

AP53556PU-N

USD 450.00

2 Weeks

RACGAP1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IF, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 30-58 amino acids from the N-terminal region of Human RACGAP1

RACGAP1 Goat Polyclonal Antibody

TA302684

USD 375.00

5 Days

Goat Polyclonal Antibody against RACGAP1 / MgcRacGAP

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-GRQGNFFASPMLK, from the C Terminus of the protein sequence according to NP_037409.1.

Racgap1 Rabbit Polyclonal Antibody

TA343711

USD 475.00

5 Days

Rabbit Polyclonal Anti-Racgap1 Antibody

Applications	WB
Reactivities	Rat
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-Racgap1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Racgap1. Synthetic peptide located within the following region: GPVTTPEFQLVKTPSSNSLSQRLYNLSKSTPRFGNKSKSATNLGQQGKFF

RACGAP1 Rabbit Polyclonal Antibody

AP20256PU-N

USD 370.00

2 Weeks

RACGAP1 rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat

RACGAP1 Rabbit Polyclonal Antibody

TA325784

USD 345.00

In Stock

Rabbit Polyclonal GTPase Activating Protein Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against A synthesized peptide derived from human GTPase Activating Protein

RACGAP1 Rabbit Polyclonal Antibody

TA325785

USD 345.00

In Stock

Rabbit Polyclonal GTPase Activating Protein (Ser387) Antibody (Phospho-specific)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against A synthesized peptide derived from human GTPase Activating Protein around the phosphorylation site of Serine 387
Modifications	Phospho-specific

RACGAP1 Rabbit Polyclonal Antibody

TA312359

USD 345.00

4 Weeks

Rabbit polyclonal GTPase Activating Protein antibody

Applications	IF, IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human RGAP1.

RACGAP1 Rabbit Polyclonal Antibody

TA329685

USD 310.00

5 Days

Rabbit Polyclonal Anti-RACGAP1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-RACGAP1 antibody: synthetic peptide directed towards the N terminal of human RACGAP1. Synthetic peptide located within the following region: EILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALD

RACGAP1 Rabbit Polyclonal Antibody

TA330619

USD 375.00

5 Days

Rabbit Polyclonal Anti-RACGAP1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-RACGAP1 antibody: synthetic peptide directed towards the N terminal of human RACGAP1. Synthetic peptide located within the following region: KREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQGNESIVAKTTVTVPNDGG

RACGAP1 Rabbit Polyclonal Antibody

TA343503

USD 375.00

5 Days

Rabbit Polyclonal Anti-CBFA2T2 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CBFA2T2 antibody: synthetic peptide directed towards the middle region of human CBFA2T2. Synthetic peptide located within the following region: GQGRPLLPVGRGSSARSADCSVPSPALDKTSATTSRSSTPASVTAIDTNG