Antibodies

Jump to Filters
View as table Download
RAD54 (RAD54L) Rabbit Polyclonal Antibody
TA314749

USD 345.00

In Stock

Rabbit polyclonal anti-RAD54 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD54.
RAD54 (RAD54L) (C-term) Rabbit Polyclonal Antibody
AP53565PU-N

USD 450.00

2 Weeks

RAD54 (RAD54L) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 641-671 amino acids from the C-terminal region of Human RAD54
RAD54 (RAD54L) Rabbit Polyclonal Antibody
TA341561

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAD54L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD54L antibody: synthetic peptide directed towards the N terminal of human RAD54L. Synthetic peptide located within the following region: VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGAR
RAD54 (RAD54L) Rabbit Polyclonal Antibody
TA380675

USD 220.00

3 Weeks

RAD54L Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RAD54L.
Modifications Unmodified