Rad9 (RAD9A) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Human RAD9A. |
Rad9 (RAD9A) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Human RAD9A. |
Rabbit polyclonal antibody to Rad9 (RAD9 homolog A (S. pombe))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 197 and 391 of Rad9 |
Rabbit Polyclonal Antibody against RAD9A
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This RAD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human RAD9. |
Mouse Monoclonal Rad9 Antibody (93A535)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal RAD9A Antibody
Applications | IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against RAD9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of full length human Rad9 protein |
Goat Polyclonal Antibody against RAD9A
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QGPSPVLAEDSEGE, from the C Terminus of the protein sequence according to NP_004575.1. |
Anti-RAD9A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 230 amino acids of human RAD9 homolog A (S. pombe) |
Rabbit Polyclonal Anti-RAD9A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAD9A antibody: synthetic peptide directed towards the C terminal of human RAD9A. Synthetic peptide located within the following region: SLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKKFRSLFFGSILAPVRS |
Carrier-free (BSA/glycerol-free) RAD9A mouse monoclonal antibody, clone OTI7B11 (formerly 7B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAD9A mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
RAD9A Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 162-391 of human RAD9A (NP_004575.1). |
Modifications | Unmodified |
Anti-RAD9A (RAD9) mouse monoclonal antibody, clone OTI7B11 (formerly 7B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-RAD9A (RAD9) mouse monoclonal antibody, clone OTI7B11 (formerly 7B11), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-RAD9A (RAD9) mouse monoclonal antibody, clone OTI7B11 (formerly 7B11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-RAD9A (RAD9) mouse monoclonal antibody, clone OTI7B11 (formerly 7B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-RAD9A (RAD9) mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-RAD9A (RAD9) mouse monoclonal antibody, clone OTI5D9 (formerly 5D9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-RAD9A (RAD9) mouse monoclonal antibody, clone OTI5D9 (formerly 5D9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | HRP |
Anti-RAD9A (RAD9) mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |