Rabbit Polyclonal Anti-RAD9B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAD9B antibody is: synthetic peptide directed towards the C-terminal region of Human RAD9B. Synthetic peptide located within the following region: ATHAPISIYFDFPGKPLALSIDDMLVEANFILATLADEQSRASSPQSLCL |
Rabbit Polyclonal Anti-RAD9B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD9B antibody: synthetic peptide directed towards the middle region of human RAD9B. Synthetic peptide located within the following region: SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED |
Germany
Japan
United Kingdom
China