Antibodies

Jump to Filters
View as table Download
Rag1 Rabbit Polyclonal Antibody
TA329558

USD 375.00

5 Days

Rabbit Polyclonal anti-Rag1 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rag1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT
RAG1 Rabbit Polyclonal Antibody
TA380683

USD 220.00

3 Weeks

RAG1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human RAG1 (NP_000439.1).
Modifications Unmodified