Rabbit Polyclonal Anti-RAI14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAI14 Antibody: synthetic peptide directed towards the middle region of human RAI14. Synthetic peptide located within the following region: ELSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAE |
Rabbit Polyclonal Anti-RAI14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAI14 Antibody: synthetic peptide directed towards the middle region of human RAI14. Synthetic peptide located within the following region: LSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAED |
RAI14 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 300-600 of human RAI14 (NP_056392.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China