Rabbit Polyclonal Anti-Rapgef2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | The immunogen for Anti-Rapgef2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rapgef2. Synthetic peptide located within the following region: GHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQSRA |
Rabbit Polyclonal anti-Rapgef2 antibody
| Reactivities | Human, Mouse |
| Immunogen | The immunogen for anti-Rapgef2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SILPQKPYNDIGIGQSQDDSIVGLRQTKHIPAALPVSGTLSSSNPDLLQS |
Germany
Japan
United Kingdom
China