Rabbit Polyclonal Anti-RAVER1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAVER1 antibody: synthetic peptide directed towards the N terminal of human RAVER1. Synthetic peptide located within the following region: VTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFR |
Rabbit Polyclonal Anti-RAVER1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAVER1 antibody: synthetic peptide directed towards the middle region of human RAVER1. Synthetic peptide located within the following region: ALLQLALQTQGQKKPGILGDSPLGALQPGAQPANPLLGELPAGGGLPPEL |
RAVER1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 55-83 amino acids from the N-terminal region of Human RAVER1. |
RAVER1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 390-490 of human RAVER1 (NP_597709.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
