Rabbit Polyclonal anti-RBM10 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM10 antibody: synthetic peptide directed towards the N terminal of human RBM10. Synthetic peptide located within the following region: MDYRSYPREYGSQEGKHDYDDSSEEQSAEDSYEASPGSETQRRRRRRHRH |
Rabbit Polyclonal anti-RBM10 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM10 antibody: synthetic peptide directed towards the N terminal of human RBM10. Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS |
RBM10 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 84-113 amino acids from the N-terminal region of Human RBM10. |
RBM10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RBM10 |
RBM10 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RBM10 |
RBM10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human RBM10 (NP_005667.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
