Rabbit Polyclonal Anti-RBM28 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM28 antibody: synthetic peptide directed towards the C terminal of human RBM28. Synthetic peptide located within the following region: QTKAEVEQVELPDGKKRRKVLALPSHRGPKIRLRDKGKVKPVHPKKPKPQ |
Rabbit Polyclonal Anti-Rbm28 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rbm28 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rbm28. Synthetic peptide located within the following region: QKKQQLASSVQAPKRKAKENKAEARFNQLVEQYKQKLLGPSKGAPLMKRS |
RBM28 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 69-99 amino acids from the N-terminal region of Human RBM28. |
Germany
Japan
United Kingdom
China
