Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RBM38 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM38 antibody: synthetic peptide directed towards the N terminal of human RBM38. Synthetic peptide located within the following region: LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER |
Rabbit Polyclonal Anti-RBM38 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM38 antibody: synthetic peptide directed towards the middle region of human RBM38. Synthetic peptide located within the following region: QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM |
Rabbit Polyclonal Anti-RBM38 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human RBM38 |
Active filters
Target Symbol
- RBM38