Antibodies

Jump to Filters
View as table Download
RBP1 Rabbit Polyclonal Antibody
TA590146

USD 482.00

In Stock

Rabbit Polyclonal Retinol Binding Protein RBP Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the entire range of the target protein.
RBP1 Rabbit Polyclonal Antibody
TA346334

USD 410.00

5 Days

Rabbit Polyclonal Anti-RBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBP1 antibody: synthetic peptide directed towards the middle region of human RBP1. Synthetic peptide located within the following region: IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG
Rbp1 Goat Polyclonal Antibody
TA303002

USD 375.00

5 Days

Goat Polyclonal Antibody against RBP1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence VEGVVCKQVFKKVQ, from the C Terminus of the protein sequence according to NP_002890.1.
RBP1 Mouse Monoclonal Antibody [Clone ID: OTI2H3]
CF502755

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) RBP1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RBP1 Mouse Monoclonal Antibody [Clone ID: OTI2E1]
CF502835

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) RBP1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RBP1 Rabbit Polyclonal Antibody
TA359714

USD 360.00

5 Days

RBP1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RBP1
RBP1 Rabbit Polyclonal Antibody
TA380797

USD 275.00

3 Weeks

RBP1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 63-197 of human RBP1 (NP_002890.2).
Modifications Unmodified
RBP1 Mouse Monoclonal Antibody [Clone ID: OTI2H3]
TA502755

USD 447.00

In Stock

RBP1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H3]
TA502755AM

USD 509.00

2 Weeks

RBP1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
RBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]
TA502755BM

USD 509.00

2 Weeks

RBP1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
RBP1 Mouse Monoclonal Antibody [Clone ID: OTI2H3]
TA502755S

USD 200.00

In Stock

RBP1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RBP1 Mouse Monoclonal Antibody [Clone ID: OTI2E1]
TA502835

USD 447.00

In Stock

RBP1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E1]
TA502835AM

USD 509.00

2 Weeks

RBP1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
RBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E1]
TA502835BM

USD 509.00

2 Weeks

RBP1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
RBP1 Mouse Monoclonal Antibody [Clone ID: OTI2E1]
TA502835S

USD 200.00

In Stock

RBP1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated