Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to RBP-Jkappa (recombination signal binding protein for immunoglobulin kappa J region)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 258 and 500 of RBP-Jkappa (Uniprot ID#Q06330) |
Rabbit polyclonal RBPJ Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RBPJ antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-29 amino acids from the N-terminal region of human RBPJ. |
Rabbit Polyclonal anti-RBPSUH antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBPSUH antibody: synthetic peptide directed towards the C terminal of human RBPSUH. Synthetic peptide located within the following region: RPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS |
Rabbit Polyclonal Anti-Rbpj Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rbpj antibody is: synthetic peptide directed towards the middle region of Mouse Rbpj. Synthetic peptide located within the following region: MGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAET |
Carrier-free (BSA/glycerol-free) RBPJ mouse monoclonal antibody,clone OTI4G10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RBPJ mouse monoclonal antibody,clone OTI6G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RBPJ Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse RBPJ |
RBPJK Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human RBPJK |
RBPJK Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
RBPJ mouse monoclonal antibody,clone OTI4G10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RBPJ mouse monoclonal antibody,clone OTI4G10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
RBPJ mouse monoclonal antibody,clone OTI4G10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RBPJ mouse monoclonal antibody,clone OTI4G10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RBPJ mouse monoclonal antibody,clone OTI6G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RBPJ mouse monoclonal antibody,clone OTI6G5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
RBPJ mouse monoclonal antibody,clone OTI6G5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RBPJ mouse monoclonal antibody,clone OTI6G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
RBPJ mouse monoclonal antibody,clone OTI4B11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- RBPJ