Rabbit Polyclonal Anti-ZFYVE20 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFYVE20 antibody: synthetic peptide directed towards the N terminal of human ZFYVE20. Synthetic peptide located within the following region: MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKS |
Goat Polyclonal Antibody against ZFYVE20
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ELKHTLAKQKGGTD, from the C Terminus of the protein sequence according to NP_071735. |
Rabbit polyclonal anti-ZFYVE20 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZFYVE20. |
RBSN Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human RBNS5 |
Germany
Japan
United Kingdom
China