Germany
Japan
United Kingdom
China
Rabbit anti-RCAN1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RCAN1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RCAN1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RCAN1 antibody: synthetic peptide directed towards the N terminal of human RCAN1. Synthetic peptide located within the following region: MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWS |
Rabbit polyclonal RCAN1 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RCAN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 41-68 amino acids from the N-terminal region of human RCAN1. |
Goat Anti-Calcipressin-1 (RCAN1) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HIGSSHLAPPNPD, from the internal region of the protein sequence according to NP_004405.3; NP_981962.1; NP_981963.1. |
Rabbit polyclonal anti-RCAN1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human RCAN1. |
Rabbit Polyclonal anti-Rcan1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rcan1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Rcan1. Synthetic peptide located within the following region: HLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPLSAAD |
Rabbit Polyclonal Anti-RCAN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RCAN1 antibody: synthetic peptide directed towards the middle region of human RCAN1. Synthetic peptide located within the following region: PVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEME |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- RCAN1