Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-Recoverin antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Recoverin. |
Rabbit Polyclonal Anti-RCVRN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RCVRN antibody: synthetic peptide directed towards the C terminal of human RCVRN. Synthetic peptide located within the following region: DVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLI |
Rabbit Polyclonal Anti-RCVRN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RCVRN antibody: synthetic peptide directed towards the N terminal of human RCVRN. Synthetic peptide located within the following region: GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQS |
Rabbit Polyclonal Anti-RCV1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RCV1 Antibody: synthetic peptide directed towards the C terminal of human RCV1. Synthetic peptide located within the following region: KMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANK |
RCVRN Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RCVRN (NP_002894.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RCVRN