Rabbit Polyclonal Anti-RDH10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RDH10 antibody: synthetic peptide directed towards the N terminal of human RDH10. Synthetic peptide located within the following region: QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG |
Rdh10 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
RDH10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 27-293 of human RDH10 (NP_742034.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China