Antibodies

View as table Download

Rabbit Polyclonal Anti-REEP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-REEP1 antibody: synthetic peptide directed towards the middle region of human REEP1. Synthetic peptide located within the following region: AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI

Rabbit Polyclonal Anti-REEP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-REEP1 antibody: synthetic peptide directed towards the C terminal of human REEP1. Synthetic peptide located within the following region: ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA

REEP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 101-201 of human REEP1 (NP_075063.1).
Modifications Unmodified