Rabbit Polyclonal Anti-RELB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RELB antibody: synthetic peptide directed towards the middle region of human RELB. Synthetic peptide located within the following region: DLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQAPGPGDGGTASL |
Rabbit Polyclonal RelB (Ser552) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human RelB around the phosphorylation site of Serine 552 |
| Modifications | Phospho-specific |
Rabbit polyclonal RelB (Ser552) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RelB around the phosphorylation site of serine 552 (L-L-SP-P-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal RelB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human RelB |
Rabbit Polyclonal Anti-RELB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RELB antibody: synthetic peptide directed towards the middle region of human RELB. Synthetic peptide located within the following region: FTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDH |
Rabbit Polyclonal Anti-RELB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RELB Antibody: synthetic peptide directed towards the C terminal of human RELB. Synthetic peptide located within the following region: GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT |
Rabbit Polyclonal Anti-RELB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RELB antibody: synthetic peptide directed towards the middle region of mouse RELB. Synthetic peptide located within the following region: FLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELSSSDPHG |
Rabbit Polyclonal Anti-RELB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RELB antibody: synthetic peptide directed towards the N terminal of human RELB. Synthetic peptide located within the following region: LRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRST |
Rabbit Polyclonal Anti-RELB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human RELB |
RELB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Relb Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Relb |
RELB Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human RELB |
RELB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 380-579 of human RELB (NP_006500.2). |
| Modifications | Unmodified |
Rel B Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
