Antibodies

Jump to Filters
View as table Download
RER1 Rabbit Polyclonal Antibody
TA341877

USD 375.00

5 Days

Rabbit Polyclonal Anti-RER1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RER1 antibody: synthetic peptide directed towards the middle region of human RER1. Synthetic peptide located within the following region: GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF