Antibodies

Jump to Filters
View as table Download
FAM101A (RFLNA) Rabbit Polyclonal Antibody
TA337588

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM101A Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-FAM101A antibody: synthetic peptide directed towards the middle region of human FAM101A. Synthetic peptide located within the following region: QLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQ
RFLNA Rabbit Polyclonal Antibody
TA369585

USD 380.00

4 Weeks

RFLNA rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RFLNA