Rabbit Polyclonal Anti-RFTN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFTN2 antibody: synthetic peptide directed towards the N terminal of human RFTN2. Synthetic peptide located within the following region: MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSN |
RFTN2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 412-501 of human RFTN2 (NP_653230.2). |
| Modifications | Unmodified |
RFTN2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 412-501 of human RFTN2 (NP_653230.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China