Rabbit Polyclonal Anti-SRSF3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SRSF3 antibody was raised against a 19 amino acid peptide near the center of human SRSF3. |
Rabbit Polyclonal Anti-SRSF3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SRSF3 antibody was raised against a 19 amino acid peptide near the center of human SRSF3. |
Rabbit polyclonal RFX1 Antibody (C-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This RFX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 896-925 amino acids from the C-terminal region of human RFX1. |
Rabbit Polyclonal Anti-RFX1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFX1 antibody: synthetic peptide directed towards the C terminal of human RFX1. Synthetic peptide located within the following region: ESEDELPQDISLAAGGESPALGPETLEPPAKLARTDARGLFVQALPSS |
Rabbit Polyclonal Anti-RFX1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RFX1 Antibody: synthetic peptide directed towards the N terminal of human RFX1. Synthetic peptide located within the following region: PQPPQPPTAAATPQPQYVTELQSPQPQAQPPGGQKQYVTELPAVPAPSQP |
Rabbit Polyclonal Anti-RFX1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RFX1 Antibody: synthetic peptide directed towards the middle region of human RFX1. Synthetic peptide located within the following region: EDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVP |
Rabbit Polyclonal Anti-Rfx1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rfx1 antibody: synthetic peptide directed towards the middle region of mouse Rfx1. Synthetic peptide located within the following region: KSGQVSLTVHSAQQVHSAPERSPVQANNSTSKTAGTPAATVQQLQVHSVQ |
RFX1 Antibody - C-terminal region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse RFX1 |
RFX1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human RFX1 (NP_002909.4). |
Modifications | Unmodified |