Germany
Japan
United Kingdom
China
Antibodies
View as table Download
RHEB Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RHEB |
Rabbit Polyclonal Rheb Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit Rheb polyclonal antibody was raised against a 14 amino acid peptide from the amino terminus of human Rheb. |
Rabbit polyclonal Anti-RHEB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RHEB antibody: synthetic peptide directed towards the middle region of human RHEB. Synthetic peptide located within the following region: VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA |
Anti-RHEB Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 150-162 amino acids of Human Ras homolog enriched in brain |
Rabbit Polyclonal Anti-RHEB Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RHEB |
RHEB rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human RHEB |
RHEB rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RHEB |
Active filters
Target Symbol
- RHEB