Antibodies

Jump to Filters
View as table Download
MIRO2 (RHOT2) Rabbit Polyclonal Antibody
TA343207

USD 375.00

5 Days

Rabbit Polyclonal Anti-RHOT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHOT2 antibody is: synthetic peptide directed towards the N-terminal region of Human RHOT2. Synthetic peptide located within the following region: TIPADVTPEKVPTHIVDYSEAEQTDEELREEIHKANVVCVVYDVSEEATI
MIRO2 (RHOT2) Rabbit Polyclonal Antibody
TA380922

USD 220.00

3 Weeks

RHOT2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 280-480 of human RHOT2 (NP_620124.1).
Modifications Unmodified