Rabbit Polyclonal Anti-RIC8B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RIC8B antibody: synthetic peptide directed towards the middle region of human RIC8B. Synthetic peptide located within the following region: KETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTE |
Rabbit Polyclonal Anti-RIC8B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RIC8B antibody: synthetic peptide directed towards the middle region of human RIC8B. Synthetic peptide located within the following region: HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL |
Germany
Japan
United Kingdom
China