Antibodies

View as table Download

RICTOR (1-99) mouse monoclonal antibody, clone 1F3, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human

Mouse Monoclonal Rictor Antibody (7B3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
TA336802 is a replacement of AM06499SU-N.

Rabbit polyclonal antibody to RICTOR

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1648 and 1708 of RICTOR (Uniprot ID#Q6R327)

Rabbit polyclonal anti-Rictor antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 1639 of mouse Rictor

RICTOR (incl. pos. control) mouse monoclonal antibody, clone 1G11, Purified

Applications WB
Reactivities Human, Mouse, Rat

Goat Polyclonal Antibody against RICTOR

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KQPIVDTSAES, from the C Terminus of the protein sequence according to NP_689969.2.

Rabbit Polyclonal Anti-RICTOR Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RICTOR

RICTOR Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG

RICTOR rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RICTOR

RICTOR Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human RICTOR (NP_689969.2).
Modifications Unmodified

Rictor (Phospho-Thr1135) polyclonal antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human Rictor around the phosphorylation site of Threonine 1135.