Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RIOK2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RIOK2 antibody: synthetic peptide directed towards the middle region of human RIOK2. Synthetic peptide located within the following region: IDYNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGD |
Rabbit Polyclonal Anti-RIOK2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RIOK2 antibody: synthetic peptide directed towards the N terminal of human RIOK2. Synthetic peptide located within the following region: SDIYIVANEEGQQFALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRL |
Carrier-free (BSA/glycerol-free) RIOK2 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RIOK2 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RIOK2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 253-552 of human RIOK2 (NP_060813.2). |
| Modifications | Unmodified |
RIOK2 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RIOK2 mouse monoclonal antibody,clone 2F4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
RIOK2 mouse monoclonal antibody,clone 2F4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
RIOK2 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RIOK2 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RIOK2 mouse monoclonal antibody,clone 3F6, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
RIOK2 mouse monoclonal antibody,clone 3F6, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
RIOK2 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
USD 420.00
5 Days
Active filters
Target Symbol
- RIOK2