Antibodies

Jump to Filters
View as table Download
RNF12 (RLIM) Rabbit Polyclonal Antibody
TA329917

USD 375.00

5 Days

Rabbit Polyclonal Anti-RNF12 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF12 antibody: synthetic peptide directed towards the C terminal of human RNF12. Synthetic peptide located within the following region: AQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGN
RNF12 (RLIM) Rabbit Polyclonal Antibody
TA329916

USD 375.00

5 Days

Rabbit Polyclonal Anti-RNF12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF12 antibody: synthetic peptide directed towards the N terminal of human RNF12. Synthetic peptide located within the following region: MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDN
RNF12 (RLIM) Mouse Monoclonal Antibody [Clone ID: OTI2D7]
CF811692

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RLIM mouse monoclonal antibody,clone OTI2D7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RNF12 (RLIM) Rabbit Polyclonal Antibody
TA380947

USD 220.00

3 Weeks

RLIM Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 535-624 of human RLIM (NP_057204.2).
Modifications Unmodified
RNF12 (RLIM) Mouse Monoclonal Antibody [Clone ID: OTI2D7]
TA811692

USD 379.00

In Stock

RLIM mouse monoclonal antibody,clone OTI2D7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RNF12 (RLIM) Mouse Monoclonal Antibody [Clone ID: OTI2D7]
TA811692S

USD 159.00

2 Days

RLIM mouse monoclonal antibody,clone OTI2D7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated