Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-RMD3 antibody for SISCAPA, clone OTIR1A2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-FAM82C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAM82C antibody: synthetic peptide directed towards the middle region of human FAM82C. Synthetic peptide located within the following region: LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA |
Rabbit Polyclonal Anti-RMDN3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RMDN3 |
RMDN3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human RMDN3 |
RMDN3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FAM82A2 |
RMDN3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FAM82A2 |
RMDN3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RMDN3 |
Active filters
Target Symbol
- RMDN3