Antibodies

Jump to Filters
View as table Download
Ribonuclease T2 (RNASET2) (N-term) Rabbit Polyclonal Antibody
AP53699PU-N

USD 450.00

2 Weeks

Ribonuclease T2 (RNASET2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human RNT2
Ribonuclease T2 (RNASET2) Rabbit Polyclonal Antibody
TA319755

USD 430.00

5 Days

Rabbit Polyclonal RNASET2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RNASET2 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human RNASET2.
Ribonuclease T2 (RNASET2) Rabbit Polyclonal Antibody
TA332101

USD 375.00

5 Days

Rabbit Polyclonal Anti-RNASET2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RNASET2 Antibody: synthetic peptide directed towards the middle region of human RNASET2. Synthetic peptide located within the following region: RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI
Ribonuclease T2 (RNASET2) Rabbit Polyclonal Antibody
TA350352

USD 345.00

In Stock

Rabbit Polyclonal Anti-RNASET2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RNASET2
RNASET2 Rabbit Polyclonal Antibody
TA364972

USD 380.00

4 Weeks

RNASET2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RNASET2