Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RND3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RND3 antibody is: synthetic peptide directed towards the C-terminal region of Human RND3. Synthetic peptide located within the following region: TLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTV |
RND3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RND3 |
RND3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RND3 |
RND3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 145-244 of human RND3 (NP_005159.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RND3