Germany
Japan
United Kingdom
China
Goat Anti-RNF13 / RZF Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Immunogen | Peptide with sequence HKFKKGDEYDVC, from the internal region of the protein sequence according to NP_009213.1; NP_899237.1; NP_899239.2; NP_899240.2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RNF13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF13 antibody: synthetic peptide directed towards the N terminal of human RNF13. Synthetic peptide located within the following region: ILAYNFENASQTFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPV |
Rabbit Polyclonal Anti-Rnf13 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rnf13 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rnf13. Synthetic peptide located within the following region: IGESSANSLKDEFTYEKGGHIILVPELSLPLEYYLIPFLIIVGICLILIV |
RNF13 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RNF13 |
RNF13 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 204-381 of human RNF13 (NP_009213.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RNF13