Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-TRC8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HTGAAAEEFNDDT, from the C Terminus of the protein sequence according to NP_009149.2. |
Rabbit Polyclonal Anti-RNF139 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF139 antibody: synthetic peptide directed towards the N terminal of human RNF139. Synthetic peptide located within the following region: SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR |
Rabbit Polyclonal Anti-RNF139 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human RNF139 |
Active filters
Target Symbol
- RNF139