Antibodies

Jump to Filters
View as table Download
RNF38 (N-term) Rabbit Polyclonal Antibody
AP53692PU-N

USD 450.00

2 Weeks

RNF38 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 47-77 amino acids from the N-terminal region of human RNF38
RNF38 Rabbit Polyclonal Antibody
TA330460

USD 310.00

5 Days

Rabbit Polyclonal Anti-RNF38 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF38 antibody: synthetic peptide directed towards the N terminal of human RNF38. Synthetic peptide located within the following region: FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP