Rabbit Polyclonal Anti-RNF8 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF8 antibody: synthetic peptide directed towards the C terminal of human RNF8. Synthetic peptide located within the following region: MEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENE |
Rabbit Monoclonal antibody against RNF8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against RNF8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence GEPGFFVTGDRAG-C, from the N Terminus of the protein sequence according to NP_003949.1; NP_898901.1. |
Germany
Japan
United Kingdom
China
