Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 29 of 29 results

(reset)

Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody

TA344582

USD 475.00

5 Days

Rabbit Polyclonal Anti-RNH1 Antibody - middle region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-RNH1 antibody: synthetic peptide directed towards the middle region of human RNH1. Synthetic peptide located within the following region: RELCQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNN

Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody

TA344583

USD 475.00

5 Days

Rabbit Polyclonal Anti-RNH1 Antibody - middle region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-RNH1 antibody: synthetic peptide directed towards the middle region of human RNH1. Synthetic peptide located within the following region: LLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEG

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: AT1H23]

AM09083PU-N

USD 340.00

2 Weeks

Ribonuclease Inhibitor (RNH1) mouse monoclonal antibody, clone AT1H23, Purified

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: AT1H23]

AM09083PU-S

USD 230.00

2 Weeks

Ribonuclease Inhibitor (RNH1) mouse monoclonal antibody, clone AT1H23, Purified

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody

TA324489

USD 450.00

5 Days

Rabbit polyclonal RNH1 Antibody (C-term)

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This RNH1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 425-454 amino acids from the C-terminal region of human RNH1.

1 / 2

2 / 2

Previous Next

Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody

TA330921

USD 375.00

5 Days

Rabbit Polyclonal Anti-RNH1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-RNH1 antibody is: synthetic peptide directed towards the N-terminal region of Human RNH1. Synthetic peptide located within the following region: YCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQ

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI4G4]

CF501874

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RNH1 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI3F11]

CF501875

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RNH1 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI2B1]

CF501965

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RNH1 mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI1B7]

CF501981

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RNH1 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody

TA350353

USD 345.00

In Stock

Rabbit Polyclonal Anti-RNH1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human RNH1

RNH1 Rabbit Polyclonal Antibody

TA369318

USD 380.00

4 Weeks

RNH1 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human RNH1

Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody

TA381003

USD 220.00

3 Weeks

RNH1 Rabbit polyclonal Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 202-461 of human RNH1 (NP_002930.2).
Modifications	Unmodified

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI4G4]

TA501874

USD 379.00

In Stock

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G4]

TA501874AM

USD 420.00

4 Weeks

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI4G4 (formerly 4G4), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G4]

TA501874BM

USD 420.00

4 Weeks

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI4G4 (formerly 4G4), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI4G4]

TA501874S

USD 159.00

2 Days

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI3F11]

TA501875

USD 379.00

In Stock

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F11]

TA501875AM

USD 420.00

4 Weeks

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI3F11 (formerly 3F11), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Biotin

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F11]

TA501875BM

USD 420.00

4 Weeks

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI3F11 (formerly 3F11), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	HRP

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI3F11]

TA501875S

USD 159.00

2 Days

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI2B1]

TA501965

USD 379.00

In Stock

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B1]

TA501965AM

USD 420.00

4 Weeks

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI2B1 (formerly 2B1), Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B1]

TA501965BM

USD 420.00

4 Weeks

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI2B1 (formerly 2B1), HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI2B1]

TA501965S

USD 159.00

2 Days

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI1B7]

TA501981

USD 379.00

In Stock

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B7]

TA501981AM

USD 420.00

4 Weeks

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI1B7 (formerly 1B7), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B7]

TA501981BM

USD 420.00

4 Weeks

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI1B7 (formerly 1B7), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI1B7]

TA501981S

USD 159.00

2 Days

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

1 - 29 of 29 results