Antibodies

View as table Download

Goat Anti-RORC (aa200-212) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CHLEYSPERGKAE, from the internal region of the protein sequence according to NP_005051.2; NP_001001523.1.

ROR gamma (RORC) (Modulating Domain) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Synthetic 14 amino acid peptide from modulating domain of human ROR-gamma

Mouse Monoclonal ROR gamma/RORC/NR1F3 Antibody (4G419)

Applications FC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

Rabbit Polyclonal Anti-RORC Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RORC antibody is: synthetic peptide directed towards the N-terminal region of Human RORC. Synthetic peptide located within the following region: MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEG

Rabbit polyclonal anti-RORG antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RORG.

Rabbit Polyclonal ROR gamma/RORC/NR1F3 Antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 1-50 of human ROR gamma was used as the immunogen.

Rabbit Polyclonal Anti-RORC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORC antibody: synthetic peptide directed towards the N terminal of human RORC. Synthetic peptide located within the following region: EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS

Rabbit Polyclonal Anti-RORC Antibody (Ligand-binding Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen RORC / ROR Gamma antibody was raised against synthetic 18 amino acid peptide from ligand-binding domain of human ROR Gamma. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Tamarin, Elephant, Bat (100%); Bovine, Rabbit, Horse (94%); Mouse, Rat, Hamster, Panda (89%); Dog (83%).

Mouse Monoclonal anti-ROR? Antibody

Applications WB
Reactivities Human, Weakly Cross-Reactive with Mouse
Conjugation Unconjugated

Hamster Polyclonal anti-ROR gamma Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-RORC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RORC Antibody: synthetic peptide directed towards the C terminal of human RORC. Synthetic peptide located within the following region: DEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILA

Rabbit Polyclonal Anti-RORC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RORC Antibody: synthetic peptide directed towards the middle region of human RORC. Synthetic peptide located within the following region: CHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPD

Rabbit Polyclonal Anti-Rorc Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rorc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG

Carrier-free (BSA/glycerol-free) RORC mouse monoclonal antibody,clone OTI3C12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RORC mouse monoclonal antibody,clone OTI3C9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RORC mouse monoclonal antibody,clone OTI1G3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human RORC (NP_005051.2).
Modifications Unmodified

RORC mouse monoclonal antibody,clone OTI3C12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORC mouse monoclonal antibody,clone OTI3C12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORC mouse monoclonal antibody,clone OTI3C9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORC mouse monoclonal antibody,clone OTI3C9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORC mouse monoclonal antibody,clone OTI1G3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORC mouse monoclonal antibody,clone OTI1G3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated