Germany
Japan
United Kingdom
China
Goat Anti-RORC (aa200-212) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CHLEYSPERGKAE, from the internal region of the protein sequence according to NP_005051.2; NP_001001523.1. |
Antibodies
View as table Download
ROR gamma (RORC) (Modulating Domain) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Synthetic 14 amino acid peptide from modulating domain of human ROR-gamma |
Rabbit Polyclonal Anti-RORC Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RORC antibody is: synthetic peptide directed towards the N-terminal region of Human RORC. Synthetic peptide located within the following region: MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEG |
Rabbit polyclonal anti-RORG antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RORG. |
Rabbit Polyclonal Anti-RORC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORC antibody: synthetic peptide directed towards the N terminal of human RORC. Synthetic peptide located within the following region: EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS |
Rabbit Polyclonal Anti-RORC Antibody (Ligand-binding Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | RORC / ROR Gamma antibody was raised against synthetic 18 amino acid peptide from ligand-binding domain of human ROR Gamma. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Tamarin, Elephant, Bat (100%); Bovine, Rabbit, Horse (94%); Mouse, Rat, Hamster, Panda (89%); Dog (83%). |
Mouse Monoclonal anti-ROR? Antibody
| Applications | WB |
| Reactivities | Human, Weakly Cross-Reactive with Mouse |
| Conjugation | Unconjugated |
Hamster Polyclonal anti-ROR gamma Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RORC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RORC Antibody: synthetic peptide directed towards the C terminal of human RORC. Synthetic peptide located within the following region: DEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILA |
Rabbit Polyclonal Anti-RORC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RORC Antibody: synthetic peptide directed towards the middle region of human RORC. Synthetic peptide located within the following region: CHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPD |
Rabbit Polyclonal Anti-Rorc Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rorc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG |
Carrier-free (BSA/glycerol-free) RORC mouse monoclonal antibody,clone OTI3C12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RORC mouse monoclonal antibody,clone OTI3C9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RORC mouse monoclonal antibody,clone OTI1G3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RORC Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human RORC (NP_005051.2). |
| Modifications | Unmodified |
RORC mouse monoclonal antibody,clone OTI3C12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RORC mouse monoclonal antibody,clone OTI3C12, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
RORC mouse monoclonal antibody,clone OTI3C12, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RORC mouse monoclonal antibody,clone OTI3C12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RORC mouse monoclonal antibody,clone OTI3C9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RORC mouse monoclonal antibody,clone OTI3C9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
RORC mouse monoclonal antibody,clone OTI3C9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RORC mouse monoclonal antibody,clone OTI3C9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RORC mouse monoclonal antibody,clone OTI1G3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RORC mouse monoclonal antibody,clone OTI1G3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
RORC mouse monoclonal antibody,clone OTI1G3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RORC mouse monoclonal antibody,clone OTI1G3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RORC