Antibodies

Jump to Filters
View as table Download
RPL37A Rabbit Polyclonal Antibody
TA336206

USD 375.00

5 Days

Rabbit Polyclonal Anti-RPL37A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPL37A Antibody: synthetic peptide directed towards the middle region of human RPL37A. Synthetic peptide located within the following region: CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD
RPL37A Rabbit Polyclonal Antibody
TA359511

USD 360.00

5 Days

RPL37A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human RL37A