Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RPS23 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human RPS23. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Rps23 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rps23 antibody is: synthetic peptide directed towards the N-terminal region of Rat Rps23. Synthetic peptide located within the following region: SHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNS |
RPS23 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human RPS23 (NP_001016.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RPS23