Antibodies

Jump to Filters
View as table Download
RPS3A Rabbit Polyclonal Antibody
TA308427

USD 415.00

5 Days

Rabbit Polyclonal antibody to RPS3A (ribosomal protein S3A)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 14 and 264 of RPS3A (Uniprot ID#P61247)
RPS3A Rabbit Polyclonal Antibody
TA336162

USD 375.00

5 Days

Rabbit Polyclonal Anti-RPS3A Antibody

Applications WB
Reactivities Arabidopsis thaliana, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS3A Antibody: synthetic peptide directed towards the N terminal of human RPS3A. Synthetic peptide located within the following region: APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF
RPS3A Rabbit Polyclonal Antibody
TA381114

USD 220.00

3 Weeks

RPS3A Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human RPS3A (NP_000997.1).
Modifications Unmodified