Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-RPS7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RPS7. |
Rabbit Polyclonal Anti-RPS7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RPS7 Antibody: synthetic peptide directed towards the N terminal of human RPS7. Synthetic peptide located within the following region: MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE |
Rabbit Polyclonal Anti-RPS7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RPS7 Antibody: synthetic peptide directed towards the middle region of human RPS7. Synthetic peptide located within the following region: RIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEF |
RPS7 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPS7 |
RPS7 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPS7 |
RPS7 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human RPS7 (NP_001002.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RPS7