Rabbit Polyclonal Anti-RPUSD2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPUSD2 antibody: synthetic peptide directed towards the N terminal of human RPUSD2. Synthetic peptide located within the following region: LKDNDFLRNTVHRHEPPVTAEPIRLLAENEDVVVVDKPSSIPVHPCGRFR |
Rabbit Polyclonal Anti-RPUSD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPUSD2 antibody: synthetic peptide directed towards the C terminal of human RPUSD2. Synthetic peptide located within the following region: AEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEE |
RPUSD2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPUSD2 |
RPUSD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 286-545 of human RPUSD2 (NP_689473.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
