Rabbit polyclonal anti-RAD antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD. |
Rabbit polyclonal anti-RAD antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD. |
Goat Anti-RRAD (aa36-48) Antibody
Applications | WB |
Reactivities | Mouse |
Immunogen | Peptide with sequence C-HRRSMPVDERDLQ, from the internal region of the protein sequence according to NP_004156.1. |
Rabbit polyclonal Anti-RRAD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RRAD antibody: synthetic peptide directed towards the middle region of human RRAD. Synthetic peptide located within the following region: LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG |
Rabbit polyclonal Anti-RRAD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RRAD antibody: synthetic peptide directed towards the middle region of human RRAD. Synthetic peptide located within the following region: YDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQ |
Anti-RRAD Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 173-178 amino acids of human Ras-related associated with diabetes |
Anti-RRAD Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 173-178 amino acids of human Ras-related associated with diabetes |