Antibodies

Jump to Filters
View as table Download
RRAGB Rabbit Polyclonal Antibody
TA331223

USD 375.00

5 Days

Rabbit Polyclonal Anti-RRAGB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RRAGB antibody is: synthetic peptide directed towards the C-terminal region of Human RRAGB. Synthetic peptide located within the following region: IDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLM
RRAGB Rabbit Polyclonal Antibody
TA357042

USD 360.00

5 Days

RRAGB Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human RRAGB